TAA7G_RAT Q923Y1
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923Y1
Recommended name：Trace amine-associated receptor 7g
EC number：
Alternative names：Trace amine receptor 9 1 Publication (TaR-9 1 Publication)
Cleaved into：
GeneID：294131
Gene names (primary )：Taar7g
Gene names (synonym )：Ta9 1 Publication, Tar9 1 Publication, Trar9 1 Publication
Gene names (ORF )：
Length：358
Mass：39,963
Sequence：MATDDGSFPWTQESILSRDLLSALSPQLCYENLNRSCVRSPYSPGSRLILYAVFGFGAVLAVCGNLLVMTSILHFRQLHSPANFLVASLACADLLVGLTVMPFSMVRSVEGCWYFGDSYCKLHSCFDISFCSSSLLHLCFISVDRHIAVSDPLIYPTRFTASVSGKYITFSWLLSIIYGFSLIYTGASEAGLEDLVSALTCVGGCQVAVNQSWVFINFLLFLVPALVMMTVYSKIFLIAKQQAQNMEKMSKQTARASDSYKDRVAKRERKAAKTLGIAVAAFLLSWLPYFVDSIIDAFLGFITPTYVYEILAWIAYYNSAMNPLIYAFFYPWFRKAIKLIVTGKILKENSSTINLFPE
Tissue specificity：
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family