LY65C_RAT   Q8CHN2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8CHN2

Recommended name:Lymphocyte antigen 6 complex locus protein G5c

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Ly6g5c

Gene names  (synonym ):Re8

Gene names  (ORF ):

Length:145

Mass:15,985

Sequence:MSGLAASWSLKPLGPHGVTQALCAVLLAVLVTMNVVLGDTLLDIPSQSPPLNQYLHCYRCLLETEELGCLLGSDTCLTPLGSTCVTLHIKNSSGFNVMVSDCRNKEQMVDCSYTRASPVFGFWIFYQCCFLDFCNNPKNRKNTMH

Tissue specificity:Expression restricted to the caput of epididymis. Detected only from day 24 postnatum. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp