GP119_RAT   Q7TQN8


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TQN8

Recommended name:Glucose-dependent insulinotropic receptor

EC number:

Alternative names:

Cleaved into:

GeneID:302813

Gene names  (primary ):Gpr119

Gene names  (synonym ):

Gene names  (ORF ):

Length:468

Mass:51,686

Sequence:MESSFSFGVILAVLTILIIAVNALVVVAMLLSIYKNDGVGLCFTLNLAVADTLIGVAISGLVTDQLSSSAQHTQKTLCSLRMAFVTSSAAASVLTVMLIAFDRYLAIKQPLRYFQIMNGLVAGGCIAGLWLISYLIGFLPLGVSIFQQTTYHGPCTFFAVFHPRFVLTLSCAGFFPAVLLFVFFYCDMLKIASVHSQHIRKMEHAGAMVGACRPPRPVNDFKAVRTVSVLIGSFTLSWSPFLITSIVQVACHKCCLYQVLEKYLWLLGVGNSLLNPLIYAYWQREVRQQLCHMALGLLADGSTQPQIETLKGKEERKKVGRKTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDACDTQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDTQTLYTCDAQTLYTCDAQTLYTCDAQTLYTCDAQTLYTSSLVTGQTEQTPLKRANMSDPLRTCRG

Tissue specificity:Expression restricted to the beta-cells of pancreatic islets. 2 s

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp