MRGRD_RAT   Q7TN41


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TN41

Recommended name:Mas-related G-protein coupled receptor member D

EC number:

Alternative names:

Cleaved into:

GeneID:293648

Gene names  (primary ):Mrgprd

Gene names  (synonym ):Mrgd

Gene names  (ORF ):

Length:319

Mass:35,830

Sequence:MNYTPYSSPAPGLTISPTMDPVTWVYFSVTFLAMATCVCGIVGNSMVIWLLSFHRVQRSPFCTYVLNLAVADLLFLLCMASLLSLETGPLLTASTSARVYEGMKRIKYFAYTAGLSLLTAISTQRCLSVLFPIWYKCHRPQHLSGVVCGVLWALALLMNFLASFFCVQFWHPDKYQCFKVDMVFNSLILGIFMPVMVLTSAIIFIRMRKNSLLQRRQPRRLYVVILTSVLVFLTCSLPLGINWFLLYWVELPQAVRLLYVCSSRFSSSLSSSANPVIYFLVGSQKSHRLQESLGAVLGRALQDEPEGRETPSTCTNDGV

Tissue specificity:Co-expressed in the small diameter neurons with P2X3 and VR1 in dorsal root ganglia. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp