SEGN_RAT   Q6R556


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6R556

Recommended name:Secretagogin

EC number:

Alternative names:

Cleaved into:

GeneID:306942

Gene names  (primary ):Scgn

Gene names  (synonym ):

Gene names  (ORF ):

Length:276

Mass:32,157

Sequence:MDNAHRQTQAHLDAACFWQIWQRFDKDEKGYIKETELDAFFDDLLAKFGIEDTLMEENVQKMKEQLMVGHDISKEGRILMKELASMFLSEDENFLLFFRLETPLDNSVEFMQIWRKYDADSSGFISAAELSNFLRDLFLHHKKVISEAELEEYTSTMEKIFDRNKDGRLDLNDLARILALQENFLLQFKMDASSTEERKRDFEKIFAHYDVSKTGALEGPEVDGFVKDMMELVQPSISGVDLDKFREILLRHCDVNKDGKIQKSELALCLGLKINP

Tissue specificity:Highly expressed in pancreas, in particular in pancreatic islets and pancreatic beta-cells. Detected in prostate, adrenal gland, small intestine, stomach and thyroid (at protein level). 1

Induction:

Developmental stage:Down-regulated in cultured insuloma cells after dexamethasone treatment. 1

Protein families:


   💬 WhatsApp