TR120_RAT Q67ET3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q67ET3
Recommended name：Taste receptor type 2 member 120
EC number：
Alternative names：Taste receptor type 2 member 17 (T2R17)
Cleaved into：
GeneID：690448
Gene names (primary )：Tas2r120 By Similarity
Gene names (synonym )：T2r17
Gene names (ORF )：
Length：295
Mass：33,578
Sequence：MDLTEWIVTIIMMIEFLLGNCANFFIMVVNAIDCMKRRKISSADRIITALAISRIGLLWAMLMNWHSRVYTTDTYSFQVTAFSGIIWAITNHFTTWLGTILSMFYLFKIANFSNCLFLHLKRKLDSVLLVIFLVSSLLVFAYLGVVNIKKIAWLSVHEGNVTVKSKLMNIASIRDTLLFSLINIAPFGISLTCVLLLIYSLGKHLKNMKFYGKGCQDQSTMVHIRALQTVVSFLLLYATYSSCVIISGWSIQNVPIFLFCVTIGAFYPAGHSCILIWGNQKLKQFLLLFLRQMKC
Tissue specificity：
Induction：
Developmental stage：
Protein families：