LPAR6_RAT   Q4G072


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q4G072

Recommended name:Lysophosphatidic acid receptor 6

EC number:

Alternative names:Oleoyl-L-alpha-lysophosphatidic acid receptor P2Y purinoceptor 5 (P2Y5) Purinergic receptor 5

Cleaved into:

GeneID:691774

Gene names  (primary ):Lpar6

Gene names  (synonym ):P2ry5, P2y5

Gene names  (ORF ):

Length:344

Mass:39,330

Sequence:MVSANGSHCPYDDSFKYTLYGCMFSMVFVLGLISNCVAIYIFICALKVRNETTTYMINLAMSDLLFVFTLPFRIFYFATRNWPFGDLLCKISVMLFYTNMYGSILFLTCISVDRFLAIVYPFKSKTLRTKRNAKIVCIAVWFTVMGGSAPAVFFQSTHSQGNNTSEACFENFPAATWKTYLSRIVIFIEIVGFFIPLILNVTCSSMVLRTLNKPVTLSRSKMNKTKVLKMIFVHLVIFCFCFVPYNINLILYSLVRTQTFVNCSVGAAVRTMYPITLCIAVSNCCFDPIVYYFTSDTIQNSIKMKSWSVRRSDSRFSEVQGTENFIQHNLQTLKNKIFDNESAI

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp