SIA10_RAT P61943
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61943
Recommended name：Type 2 lactosamine alpha-2,3-sialyltransferase
EC number：EC:2.4.3.6
Alternative names：CMP-NeuAc:beta-galactoside alpha-2,3-sialyltransferase VI ST3Gal VI (ST3GalVI) Sialyltransferase 10
Cleaved into：
GeneID：
Gene names (primary )：St3gal6
Gene names (synonym )：Siat10
Gene names (ORF )：
Length：331
Mass：38,145
Sequence：MKGYVVAIFLSSIFLYYVLYCILWGTNGYWFPNEEMKSKNNVKNCFKKPAFASLLRFPQFYPFLCKADFVKVAATYGTNNFLLPYGVKTFESYFRSGLSKLQSCDLVGQFDTVPCKRCVVVGNGGVLKNKTLGAKIDSYDVIIRMNNGPVLGHEEEVGKRTTFRLFYPESVFSDPSHYDPNTTAVLVVFKPQDLRWLMEILIGKKINTDGFWKKPALKLIYKQYQIRILDPYIIREAAFQLLRFPRVFPKDQKPKHPTTGIIALTLAFHICSEVHLAGFKYNFYTPDSPLHYYGNATMSLMKKNAYHNLTAEQLFLKNLIKKKMVINLTQN
Tissue specificity：
Induction：
Developmental stage：
Protein families：