PR3D1_RAT P21702
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P21702
Recommended name：Prolactin-3D1
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Prl3d1
Gene names (synonym )：Csh1, Pl1
Gene names (ORF )：
Length：230
Mass：26,324
Sequence：MQLTLTLSRASGMQLFLLVSSLLLWEKVASKPTAIVSTDDLYHCLVEQSHNTFIMAADVYREFDINFAKRSWMKDRILPLCHTASIHTPENLEEVHEMKTEDFLNSIINVSVSWKEPLKHLVVCSDCSSGASVSMGKKAVDMKDKNLIILEGLQTLYNRTQAKVEENFENFDYPAWSGLKDLDSSDEEHHLFAICNLCRCVKRDIHKIDTYLKVLRCRVVFKNECGVSTF
Tissue specificity：Placental lactogen I is expressed in mid-pregnancy, while placental lactogen II is expressed throughout the later half of pregnancy.
Induction：
Developmental stage：
Protein families：