PR4A1_RAT P09320
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P09320
Recommended name:Prolactin-4A1
EC number:
Alternative names:
Cleaved into:
GeneID:24656
Gene names (primary ):Prl4a1
Gene names (synonym ):Prlpa
Gene names (ORF ):
Length:227
Mass:26,388
Sequence:MHLSLSHQWSSWTVLLLLVSNLLLWENTASAMRAKLLNVHNYTSYGDTWNQAIKISQDMNQYISDLSTHVKIFYAQGRGFERRTTRCHTSSLSSPENKEQAQQFQLEVLLGLSHSLLQAWLNPLHHLWAEMCDRLGSTPPTLYKALMLKESNIKLLDAIKNIAKKGNFEINEKANYTAWSELGFLQSPNRDTRYFAFYNLFHCLKKDSNNVEMYLKLLKCRLIRSKC
Tissue specificity:Expressed from days 14 to term of pregnancy.
Induction:
Developmental stage:
Protein families: