TACO1_RAT   B2RYT9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B2RYT9

Recommended name:Translational activator of cytochrome c oxidase 1 By Similarity

EC number:

Alternative names:

Cleaved into:

GeneID:360645

Gene names  (primary ):Taco1 By Similarity

Gene names  (synonym ):Ccdc44 Imported

Gene names  (ORF ):

Length:295

Mass:32,754

Sequence:MMSWAAARLTETAARCFRARCLGFRVGPWCVSQHENSSYGAAPHRTLRVSAVAFAGHNKWSKVRHIKGPKDMERSRIFSKLTLSIRLAVKEGGPNPENNSSLANILEVCRSKNMPKSTIESALKSEKNKGIYLLYEGRGPGGSSLLIEALSNSGPKCHLEIKYILNKNGGMMTEGARHFFDKKGVVVVGVEDREKKAVNLERALELAIEAGAEDVREAEDEEEEKNLFKFICDASSLHQVRKKLDSLGLCSVSCSLEFIPHSKVQLSEPELEQAVHLIQALSNHEDVIHVYDNIE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp