GPR18_RAT   A1A5S3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A1A5S3

Recommended name:N-arachidonyl glycine receptor

EC number:

Alternative names:G-protein coupled receptor 18

Cleaved into:

GeneID:679957

Gene names  (primary ):Gpr18

Gene names  (synonym ):

Gene names  (ORF ):

Length:331

Mass:37,556

Sequence:MAIPSNRDQLALSNGSHPEEYKIAALVFYSCIFLIGLLVNVTALWVFSCTTKKRTTVTIYMMNVALLDLVFILSLPFRMFYYAKGEWPFGDYFCHILGALVVFYPSLALWLLALISADRYMAIVQPKYAKELKNTGKAVLACVGVWIMTLTTTVPLLLLDEDPDKASSPATCLKISDIIHLKAVNVLNFTRLIFFFLIPLFIMIGCYVVIIHSLLRGQTSKLKPKVKEKSIRIIVTLLLQVLACFVPFHICFALLMLQGEENSYSPWGAFTTFLMNLSTCLDVVLYYIVSKQFQARVISVMLYRNYLRSVRRKSVRSGSLRSLSNMNSEML

Tissue specificity:Expressed in testis, spleen and brain (at protein level). 1

Induction:

Developmental stage:

Protein families: