AAGAB_RAT   Q9R0Z7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9R0Z7

Recommended name:Alpha- and gamma-adaptin-binding protein p34

EC number:

Alternative names:

Cleaved into:

GeneID:171435

Gene names  (primary ):Aagab

Gene names  (synonym ):P34

Gene names  (ORF ):

Length:

Mass:34,363

Sequence:MAAGVPCALVTSCSATFTGDRLVQHILGTEDAVVEATSSDAVRFYPWTIDNKYYSAEVNLCVVPSKCRVTAEIAEAVQAFVVYFDSTQKSGLDSVSSWLPLAETWLPEVMILVCDRVCEDGINRQQAQEWCIKHGFELVELCPEELPEEDDDFPESTGVKRIVQALNANVWSNVVMKNDRSQGFSLLNSLAGASRSVGSAESCQCEQEPSPTAERTESLPGHRSGACGPAGAQVDSIVDPMLDLDIQELASLTTGGGDLENFERLFSKLKEMKDKAATLPHEQRKLHAEKVAKAFWMAIGGDRDEIEGLSSDDEH

Tissue specificity:Widely expressed. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp