MFS4B_RAT Q80T22
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q80T22
Recommended name：Sodium-dependent glucose transporter 1 1 Publication
EC number：
Alternative names：Major facilitator superfamily domain-containing protein 4B
Cleaved into：
GeneID：337920
Gene names (primary )：Mfsd4b
Gene names (synonym )：Naglt1
Gene names (ORF )：
Length：484
Mass：51,775
Sequence：MEFRGSGATAVEQHLLQSETPGKNGLQATSSDQVGRTLRWFTTVVLNAAFLGMGVSAAVLGPTFPDLARNVNRNISSLSEIFVGRALGYLGGSVVGGVLFDCMNHFLLLGLSHLLTAAGLYLTPFCKTAALLTAMMSITGVSFGVLDTGGNVLILDLWGDKGAPHIQALHFSFALGAFLAPLLAKLAWGTTASAQNHTEPQLDRSALNRSFEAASDSVLAVPDDMNLLWAYASIGTYVLVLSVFLFAPFFKKRSKQKKSAASAQGARRAKYHRALLCLLFLFFFFYVGAEVTYGSYVFSFATTHVGMEESEAAGLNSIFWGTFAACRGLAIFFATLLQPGTMMVLCNIGSLASSFFLVLFDKSPLCLWIASSVYGASMAATFPSGISWIEQYTTLTGKSAAFILVGAALGLMATPALSGILQGHYPDLPVILYMCLGSAVLTTVLFPVMYKVATLPLDRKQEKSINSEGQKILLSSSRLIKEAK
Tissue specificity：Expressed in brain, liver, lung, and kidney. In kidney expressed in cortex and inner medulla, in ascending thin limbs (ATLs) and lower descending thin limbs (DTLs). Primarily expressed in the proximal tubules of the kidney. 2 s
Induction：
Developmental stage：After water restriction, up-regulated in inner medulla ascending thin limbs (ATLs) and lower descending thin limbs. 1
Protein families：