SMAGP_RAT   Q7TPF1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q7TPF1

Recommended name:Small cell adhesion glycoprotein

EC number:

Alternative names:

Cleaved into:

GeneID:300236

Gene names  (primary ):Smagp

Gene names  (synonym ):

Gene names  (ORF ):

Length:97

Mass:10,712

Sequence:MNNLPATPSPEELMTTPVFQAPETMSPQAEEASTALIAVVITVVFLTLLSVVTLIFFYLYKNKGSYVTYEPAEGEPSAILQMETDSAKGKEKEEYFI

Tissue specificity:Detected in brain (at protein level). Highly expressed in kidney and placenta. Detected in skin, breast, heart, lung, liver, prostate, spleen, small intestine, colon and stomach. 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp