TA2R3_RAT   Q67ET7


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q67ET7

Recommended name:Taste receptor type 2 member 3

EC number:

Alternative names:T2R11 Taste receptor type 2 member 137 Imported

Cleaved into:

GeneID:500089

Gene names  (primary ):Tas2r3 By Similarity

Gene names  (synonym ):Tas2r137 Imported

Gene names  (ORF ):

Length:316

Mass:36,265

Sequence:MLGFTEGIFLVLTVTEFILGNLVNGFIVSVNGSHWFKSKKISLSDFIITSLALFRIFLLWIIFTDSLIIVFSYHTHDSGIRMQLIDVFWTFTNHFSIWLISCLSVFYCLKIATFSHPSFLWLKWRASRVVVGMLWGALVLSCVCTMSLMNEFKIYSALTGSRDTQNMTEYIRLKRHEYNLMHVLGNLWKIPSLIVSLIAYFLLLLSLGKHTQQMQKYSVGSRDQSAEAHRRAMRIILSFLLFFLFYFLSFVILSSSRFLPETKIARIIGVVITMSYLVGDSLILILGNNKLKQTFVAILPCECGHPKPGSKRFFAS

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp