KLRG1_RAT Q64335
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q64335
Recommended name：Killer cell lectin-like receptor subfamily G member 1
EC number：
Alternative names：
Cleaved into：
GeneID：58975
Gene names (primary )：Klrg1
Gene names (synonym )：Mafa
Gene names (ORF )：
Length：188
Mass：21,356
Sequence：MADNSIYSTLELPAAPRVQDDSRWKVKAVLHRPCVSYLVMVALGLLTVILMSLLLYQRTLCCGSKGFMCSQCSRCPNLWMRNGSHCYYFSMEKRDWNSSLKFCADKGSHLLTFPDNQGVNLFQEYVGEDFYWIGLRDIDGWRWEDGPALSLSILSNSVVQKCGTIHRCGLHASSCEVALQWICEKVLP
Tissue specificity：Expressed in lung mast cells. 2 s
Induction：
Developmental stage：
Protein families：