RHOX5_RAT Q63630
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q63630
Recommended name：Homeobox protein Rhox5
EC number：
Alternative names：
Cleaved into：
GeneID：24631
Gene names (primary )：Rhox5
Gene names (synonym )：Pem
Gene names (ORF )：
Length：211
Mass：22,850
Sequence：MEAQGSSHDISRLLCLGVKEDSEEQHGQYLGDVKAEAFFQAGEGRDEKGAQGQPGEGAVGTEGEGEELNGGEGHFGPGVPGPVGEGDKDGGTRASGMEEEQHEPVAEGTESVKSEDKQMPLRRPGSTQRRLAELERILLSSGSSSGGRSLIDGWISVCPECRNWFKIRRAAYRRNRRRRTPIPEHFRATSGCPACLGARWGVRCPFATPRF
Tissue specificity：Highly expressed in placenta. Lower levels in testis, epididymis, ovary and skeletal muscle.
Induction：
Developmental stage：Expressed during embryogenesis and in adult reproductive tissue and skeletal muscle.
Protein families：