ABHGB_RAT   Q5XIL6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5XIL6

Recommended name:ABHD16B By Similarity

EC number:EC:3.1.1.111

Alternative names:Alpha/beta hydrolase domain-containing protein 16B Curated (Abhydrolase domain-containing protein 16B Imported)

Cleaved into:

GeneID:311720

Gene names  (primary ):Abhd16b

Gene names  (synonym ):

Gene names  (ORF ):

Length:474

Mass:53,294

Sequence:MCVICFVKALVHVFKIYLTANYSYNFRSWPVDFRWDDLHVPGTNNSSHRALTCAAAAAGVWLLHDAALGEDALTRPPRGARSQVQCLLQQIRELPSQLASYALAHSLGRWLVYPGSMFLMTRALLPLLQQGQERLVDRYRGRRAKLVACDGNEIDTMFMDRRQHPGSHGRGLCLVICCEGNAGFYEMGCLSAPLEAGYSVLGWNHPGFGGSTGAPFPQHDANAMDVVVKYALHRLHFSPANVVVYGWSIGGFTATWATMTYPELGALVLDATFDDLVPLALKVMPQSWKGLVVRTVREHFNLNVAEQLCCYPGPVLLLRRTQDDVVSTSGHVPSLPSCQVEGDVEGNRGNELLLRLLEHRYPSVMAREGRTVVIRWLRASNLAQETALYARYHVDDEWCLATLRSYREGRQKDLDHTKTWGPHGPSFPWFVGQGLSARRRRHLALFLARRHLKNLEATHCSPLEPEDFQLPWRL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp