NTAQ1_RAT   Q5BJV9


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5BJV9

Recommended name:Protein N-terminal glutamine amidohydrolase Curated

EC number:EC:3.5.1.122

Alternative names:Protein NH2-terminal glutamine deamidase (N-terminal Gln amidase; Nt(Q)-amidase) WDYHV motif-containing protein 1

Cleaved into:

GeneID:362914

Gene names  (primary ):Ntaq1

Gene names  (synonym ):Wdyhv1

Gene names  (ORF ):

Length:207

Mass:24,125

Sequence:MEGDSRAATASQYQPACPTRDACVYSSCYCEENIWKLCEYIKTHNQYLLEECYAVFISNEKKMVPIWKQQARPENGPVIWDYHVVLLHVSREGQSFIYDLDTILPFPCPFDIYIEDALKSDDDIHPQFRRKFRVVRADSYLKNFASDRSHMKDSSGNWREPPPEYPCIETGDSKMNLNDFISMDPAVGWGAVYTLSEFVHRFSSKNY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp