TFF3_RAT Q03191
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q03191
Recommended name：Trefoil factor 3
EC number：
Alternative names：
Cleaved into：
GeneID：25563
Gene names (primary )：Tff3
Gene names (synonym )：Itf
Gene names (ORF )：
Length：81
Mass：8,944
Sequence：METRAFWTTLLLVLVAGSSCKAQEFVGLSPSQCMVPANVRVDCGYPTVTSEQCNNRGCCFDSSIPNVPWCFKPLQETECTF
Tissue specificity：Expressed in goblet cells of the intestines, and colon, in paraventricular hypothalamus and supraoptic nuclei. Weakly expressed in gastric epithelial cells (at protein level). Expressed by goblet cells of small and large intestinal epithelia, kidney and stomach. Expressed in the paraventricular hypothalamus, arcuate nucleus and amygdala of the brain. Weakly expressed in gastric epithelial cells. 5 s
Induction：
Developmental stage：Up-regulated by hypoxia in gastric epithelial cells. Up-regulated by hypoxia-inducible factor 1 alpha (HIF1A). 1
Protein families：