ADA18_RAT P97776
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P97776
Recommended name：Disintegrin and metalloproteinase domain-containing protein 18
EC number：
Alternative names：Transmembrane metalloproteinase-like, disintegrin-like, and cysteine-rich protein III (tMDC III)
Cleaved into：
GeneID：
Gene names (primary )：Adam18
Gene names (synonym )：Tmdc3
Gene names (ORF )：
Length：445
Mass：48,200
Sequence：IYRKHLKYIGATSPGELCNESYVAGVGTYPEDIGLEGLSMVITQLIGLHIGLTYDDVDNCSCPRAPCIMQPEALSSSGMKTFSNCSVHDYTHYASKLDMQCLGDLSNVLQPKQSVCGNGIVEGSEECDCGNETECQFKECCNHETCKLKGSAQCGSGTCCTPKCELSAAGTPCRKAVDPECDFTEYCDGSSSHCVPDTFALDGHLCRLGSAYCYNGRCQALNDQCVSLFGKGSQGASYACFEKVNSQRENLANCDSKNSYSLPCGQKDVLCGKLACFRPNKNYKSSTQSVLYSYVHGSVCLSIPPGLSMRSDGKDNAYVADGTVCGPQMYCINGSCKEVNFTGNDCNAAKKCKGNGICNNFGHCQCFPDYRPPDCNLQIGSPGGSIDDGNLLRTDSALATKRLSQHADSWVILGFFIFLPFIMTLFLGIIKRNERKIVPQKEQER
Tissue specificity：Expressed specifically in testis.
Induction：
Developmental stage：Adult levels are reached by day 28 after birth.
Protein families：