MPC1_RAT P63031
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P63031
Recommended name:Mitochondrial pyruvate carrier 1
EC number:
Alternative names:
Cleaved into:
GeneID:171087
Gene names (primary ):Mpc1
Gene names (synonym ):Arbp, Brp44l
Gene names (ORF ):
Length:
Mass:12,455
Sequence:MAGALVRKAADYVRSKDFRDYLMSTHFWGPVANWGLPIAAINDMKKSPEIISGRMTFALCCYSLTFMRFAYKVQPRNWLLFACHVTNEVAQLIQGGRLINYEMSKRPSA
Tissue specificity:
Induction:
Developmental stage:
Protein families: