TIM8B_RAT P62078
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P62078
Recommended name：Mitochondrial import inner membrane translocase subunit Tim8 B
EC number：
Alternative names：
Cleaved into：
GeneID：64372
Gene names (primary )：Timm8b
Gene names (synonym )：Ddp2, Tim8b
Gene names (ORF )：
Length：83
Mass：9,286
Sequence：MAELGEADEAELQRLVAAEQQKAQFTAQVHHFMELCWDKCVEKPGSRLDSRTENCLSSCVDRFIDTTLAITGRFAQIVQKGGQ
Tissue specificity：
Induction：
Developmental stage：
Protein families：small Tim family