MTR1A_RAT P49218
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P49218
Recommended name：Melatonin receptor type 1A
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Mtnr1a
Gene names (synonym )：
Gene names (ORF )：
Length：156
Mass：18,214
Sequence：CYICHSLKYDRIYSNKNSLCYVFLIWTLTLIAIMPNLQTGTLQYDPRIYSCTFTQSVSSAYTIALVVFHFVVPMIIVTFCYLRIWILVLQVRRRVKPDSKPKLKPQDFRNFVTMFVVFVLFALCWAPLNFIGLIVASDPATMAPRIPEWLFVASYY
Tissue specificity：At least in the brain, more precisely in the pars tuberalis and the suprachiasmatic nucleus.
Induction：
Developmental stage：
Protein families：