TIP39_RAT P0C172
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P0C172
Recommended name:Tuberoinfundibular peptide of 39 residues
EC number:
Alternative names:Parathyroid hormone 2
Cleaved into:
GeneID:
Gene names (primary ):Pth2
Gene names (synonym ):Tip39, Tipf39
Gene names (ORF ):
Length:100
Mass:11,022
Sequence:METCQMSRSPRERLLLLLLLLLLVPWGTGPASGVALPLAGVFSLRAPGRAWAGLGSPLSRRSLALADDAAFRERARLLAALERRRWLDSYMQKLLLLDAP
Tissue specificity:Expressed in brain, dorsal root ganglion, eye and testis. In brain expressed in cell bodies of three distinct areas: The major one comprises the subparafascicular area posterior through the intralaminar nucleus of the thalamus; a second is the medial paralemniscal nucleus at the pontomesencephalic junction; and a third is in the dorsal and dorsolateral hypothalamic areas, which contained a few, scattered cell bodies. In brain expressed in fibers of limbic areas such as the septum, the amygdala, and the bed nucleus of the stria terminalis; of areas involved in endocrine regulation, such as the hypothalamic dorsomedial, paraventricular, periventricular, and arcuate nuclei; of auditory areas, such as the ectorhinal and temporal cortices, inferior colliculus, medial geniculate body, and some of the nuclei of the superior olivary complex; and in the dorsolateral funiculus of the spinal cord. 2 s
Induction:
Developmental stage:
Protein families: