NU4LM_RAT   P05507


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P05507

Recommended name:NADH-ubiquinone oxidoreductase chain 4L

EC number:EC:7.1.1.2

Alternative names:NADH dehydrogenase subunit 4L

Cleaved into:

GeneID:26200

Gene names  (primary ):Mt-nd4l

Gene names  (synonym ):Mtnd4l, Nd4l

Gene names  (ORF ):

Length:98

Mass:10,659

Sequence:MTSAFLNLTMAFTLSLLGTFMFRSHLMSTLLCLEGMMLSLFVMTSTSTLNSNSMISMTIPITILVFAACEAAVGLALLVKISNTYGTDYVQNLNLLQC

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp