WAP_RAT P01174
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P01174
Recommended name：Whey acidic protein
EC number：
Alternative names：Whey phosphoprotein
Cleaved into：
GeneID：114596
Gene names (primary )：Wap
Gene names (synonym )：
Gene names (ORF )：
Length：137
Mass：14,827
Sequence：MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCSDDSFSEDTECINCQTNEECAQNDMCCPSSCGRSCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCKNGCIMSCMDPEPKSPTVISFQ
Tissue specificity：Milk-specific; major protein component of milk whey.
Induction：
Developmental stage：
Protein families：