WAP_RAT   P01174


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P01174

Recommended name:Whey acidic protein

EC number:

Alternative names:Whey phosphoprotein

Cleaved into:

GeneID:114596

Gene names  (primary ):Wap

Gene names  (synonym ):

Gene names  (ORF ):

Length:137

Mass:14,827

Sequence:MRCSISLVLGLLALEVALARNLQEHVFNSVQSMCSDDSFSEDTECINCQTNEECAQNDMCCPSSCGRSCKTPVNIEVQKAGRCPWNPIQMIAAGPCPKDNPCSIDSDCSGTMKCCKNGCIMSCMDPEPKSPTVISFQ

Tissue specificity:Milk-specific; major protein component of milk whey.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp