PROF3_RAT   M0RCP6


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:M0RCP6

Recommended name:Profilin-3

EC number:

Alternative names:

Cleaved into:

GeneID:685936

Gene names  (primary ):Pfn3

Gene names  (synonym ):

Gene names  (ORF ):

Length:137

Mass:14,667

Sequence:MGDWKGYISAVLRDQRIDDVAIVGHSDNRCVWASRPGGLLAAISPQEVGVLTGPDRHTFLQTGLSVAGRRCCVIRDYLLAEGDGVLDARTKGLDGRAICVGHTPRALLVLMGRRGVHGGILNKTVHDLIGGLREQCS

Tissue specificity:Detected in round spermatids. 1

Induction:

Developmental stage:Expression coincides with the increasing numbers of round spermatids and decreases during the termination of the first spermatogenic cycle. 2 s

Protein families:


   💬 WhatsApp