TMM33_RAT   Q9Z142


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z142

Recommended name:Transmembrane protein 33

EC number:

Alternative names:

Cleaved into:

GeneID:59303

Gene names  (primary ):Tmem33

Gene names  (synonym ):Db83

Gene names  (ORF ):

Length:247

Mass:27,983

Sequence:MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALLANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSLLHAATYTKKVLDAKGSNSLPLLRSVLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQGSLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFISRLAPTVA

Tissue specificity:Highly expressed in the liver and significantly in brain, lungs and kidneys.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp