TAAR9_RAT Q923Y6
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q923Y6
Recommended name：Trace amine-associated receptor 9 1 Publication
EC number：
Alternative names：Trace amine receptor 3 1 Publication (TaR-3 1 Publication)
Cleaved into：
GeneID：319107
Gene names (primary )：Taar9 1 Publication
Gene names (synonym )：Ta3 1 Publication, Tar3 1 Publication, Trar3 1 Publication
Gene names (ORF )：
Length：338
Mass：37,846
Sequence：MELCYENVNGSCIKSSYSPWPRAILYAVLGLGALLAVFGNLLVITAILHFKQLHTPTNFLVASLACADFLVGVTVMPFSTVRSVEGCWYFGDTYCKFHTCFDTSFCFASLFHLCCISIDRYVAVTDPLTYPTKFTISVSGVCIALSWFFSVTYSFSIFYTGANEEGIEELVVALTCVGGCQAPLNQNWVLLCFLLFFLPTVVMVFLYGRIFLVAKQQARKIEGSANQPQASSESYKERVARRERKAAKTLGIAMAAFLVSWLPYIIDAVIDAYMNFITPAYVYEILVWCVYYNSAMNPLIYAFFYPWFRKAIKLIVSGKVFRADSSRTNLFSEEAGAG
Tissue specificity：Mainly expressed in neurons of the olfactory epithelium (PubMed:36551251). Also expressed in the intestine (PubMed:36551251). 1
Induction：
Developmental stage：
Protein families：G-protein coupled receptor 1 family