PR8A9_RAT Q920I0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q920I0
Recommended name：Prolactin-8A9
EC number：
Alternative names：
Cleaved into：
GeneID：
Gene names (primary )：Prl8a9
Gene names (synonym )：Prlpc2
Gene names (ORF )：
Length：241
Mass：27,736
Sequence：MELPLSQAQFSGTFLMLAVSNMLLWEKVSSIPACLAEEGGCWNPIVETFNSAMQRGETLRNLADQLYTELYHNQFSSEQFLALNSKLIRRDKTAVRAGTYCHSTLSNSPDGETKHADVETEKYLKMLINFVGAWISPLYHLVIELSAMQDVPETILSKAKDIEENKRELLDDLKWILTKVYPTAEMKEEFPSWEHLSFLKSSNKDSKFLAMFNLSKCIYNETYYILFYLRTLKCHITGKDC
Tissue specificity：Detected only in placenta. 1
Induction：
Developmental stage：
Protein families：