G6B_RAT   Q6MG59


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6MG59

Recommended name:Megakaryocyte and platelet inhibitory receptor G6b Imported

EC number:

Alternative names:

Cleaved into:

GeneID:RGD:1303269

Gene names  (primary ):Mpig6b

Gene names  (synonym ):G6b Imported

Gene names  (ORF ):

Length:232

Mass:25,083

Sequence:MALVLQLLPLLLSKVQGNPEVSLEGNPGDRVNLSCIGVSDPTRWAWAPSFPACKGLSKGRRPILWASSSGTPTVLQHFSGRLRSLDTGIKRLELLLSAGDSGTFFCKGRQENESRTVIQVLGDKAGCRPSGSTHGSEYSKVLIPLLGFGLVLGLGALGLVWWRRSCVPPSHIAPVINAEPQRPLEQDSKISGHLDQEPNLHYADLDHSVLRRHRRMSALVPGDASTVYAVVV

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp