G6PC3_RAT Q6AZ83
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q6AZ83
Recommended name：Glucose-6-phosphatase 3
EC number：EC:3.1.3.9
Alternative names：G-6-Pase 3; G6Pase 3
Cleaved into：
GeneID：303565
Gene names (primary )：G6pc3
Gene names (synonym )：
Gene names (ORF )：
Length：346
Mass：38,834
Sequence：MESTLSAGIMMAEALQNQLPGLENMWLWVTFLADPKNLFQFYFPAVYYASRRLGISLFWIAFITEWLNLVFKWFLFGDRPFWWVHESGYSAQTPVQIHQFPSSCETGPGSPSGHCMITGAALWPVMIAISSQVASQTRSPWVRVIPGLAYCTFLLAVGLSRVFLLAHFPHQVLAGLLAGVILGWLLSPRVPMERELSFYGLTALTLMLGASLMYWTLFTLGLDLSWSINLASKWCDRPEWVLVDSRPFASLSRDSGSALGLGIALHTPCYAQIRRVHLGNGQKIACFVLAMGLLVFLEWLGHPPQISLFYIFNFLKFTLWPCLVVALVPWMVHTLSAQEAPPIRSS
Tissue specificity：Expressed in liver and kidney. It is the major glucose-6-phosphatase expressed in the small intestine. 1
Induction：
Developmental stage：Up-regulated upon fasting. 1
Protein families：