MOC2B_RAT   Q6AY59


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q6AY59

Recommended name:Molybdopterin synthase catalytic subunit UniRule Annotation

EC number:EC:2.8.1.12

Alternative names:Molybdenum cofactor synthesis protein 2 large subunit UniRule Annotation Molybdenum cofactor synthesis protein 2B UniRule Annotation (MOCS2B UniRule Annotation)

Cleaved into:

GeneID:294753

Gene names  (primary ):Mocs2 UniRule Annotation

Gene names  (synonym ):

Gene names  (ORF ):

Length:200

Mass:22,233

Sequence:MSSLEINNSCFSLETKLPSSHQSVEDSASEPSGYEAKDPPQDTLKDVDDVLEKPKDIIQFTAKKLSVGEVSQLVVSPLCGAVSLFVGTTRNNFEGKKVISLEYEAYLPMAENEIRKICNDIRQKWPVRHIAVFHRLGLVPVSEASTVIAVSSAHRAASLEAVSYAIDSLKAKVPIWKKEIYEESTSSWKRNKECFWAADD

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp