LETM2_RAT   Q5PQQ5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q5PQQ5

Recommended name:LETM1 domain-containing protein LETM2, mitochondrial

EC number:

Alternative names:

Cleaved into:

GeneID:

Gene names  (primary ):Letm2

Gene names  (synonym ):

Gene names  (ORF ):

Length:459

Mass:52,524

Sequence:MAFYSYNSFLAIFWTRLPGHSVHPPCSHFPPLAFFHLPDSHLRTAYMKNCGSRKYSYPGLTGNNKVHPLRTRLPQKLHTTCWLQNHPGKPQPEQIPEEPKATDPQPTKDDQTEVAEGKWSLRQKIIDEVKYYYNGFSLLWIDTKVAARIVWRLLHGQVLTRRERRRLLRTCADVFRLVPFVVFIIVPFMEFLIPVFLKLFPDMLPSTFESESKKEEKQKKMMGAKLEIAKFLQETMTEMAKRNRAKLDDDSSDSSQLSSYVKQVQTGHKPSTKEIVRFSKLFEDQLALEHLRRPQLVALCKLLELQAFGTNNLLRFQLLMTLRSIKADDEVIAKEGVKALSVSELQAACRARGMRSLGLTEEQLRQQLTEWLDLHLKENVPPSLLLLSRTFYLIDVKPKPIELPPSIETPKTNLGIPSSPPPESKEDITDPAPQLNGTKILQAKSQETSQNSKANSKGA

Tissue specificity:Testis and sperm. 1

Induction:

Developmental stage:Expressed in the developmental stages from spermatocyte to spermatozoon. 1

Protein families:


   💬 WhatsApp