NMS_RAT Q5H8A2
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q5H8A2
Recommended name：Neuromedin-S
EC number：
Alternative names：
Cleaved into：
GeneID：497196
Gene names (primary )：Nms
Gene names (synonym )：
Gene names (ORF )：
Length：152
Mass：17,572
Sequence：MKHPFPQFPPILVIYCFCMLQIPSSGASPPLAGPPDGLDAVDPERLAHFLNQRETCSNQPKESRDVYKRFLFHYSRAWKSTHPVNSEFAPVHPLMRLAAKLPSRRMKRLPRLLHTDSRMATIDFPKKDPTTSLGRPFFLFRPRNGRYTDKVQ
Tissue specificity：Expressed in the CNS, spleen and testis. Specifically expressed in the suprachiasmatic nuclei (SCN) of the hypothalamus. 1
Induction：
Developmental stage：Expression has a diurnal peak under light/dark cycling, but remains stable under constant darkness. 1
Protein families：