NBL1_RAT Q06880
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q06880
Recommended name：Neuroblastoma suppressor of tumorigenicity 1
EC number：
Alternative names：
Cleaved into：
GeneID：50594
Gene names (primary )：Nbl1
Gene names (synonym )：Dan
Gene names (ORF )：
Length：178
Mass：19,191
Sequence：MLWVLVGTVLPVMLLAAPPPINKLALFPDKSAWCEAKNITQIVGHSGCEAKSIQNRACLGQCFSYSVPNTFPQSTESLVHCDSCMPAQSMWEIVTLECPGHEEVPRVDKLVEKIVHCSCQACGKEPSHEGLNVYMQGEDGPGSQPGSHSHSHPHPGCQTPEPEEPPGAPQVEEEGAED
Tissue specificity：Most abundant in lung, brain, intestine and kidney.
Induction：
Developmental stage：
Protein families：