ELOC_RAT P83941
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P83941
Recommended name:Elongin-C
EC number:
Alternative names:Elongin 15 kDa subunit RNA polymerase II transcription factor SIII subunit C SIII p15 Stromal membrane-associated protein SMAP1B homolog Transcription elongation factor B polypeptide 1
Cleaved into:
GeneID:64525
Gene names (primary ):Eloc
Gene names (synonym ):Tceb1
Gene names (ORF ):
Length:112
Mass:12,473
Sequence:MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
Tissue specificity:
Induction:
Developmental stage:
Protein families: