FABP7_RAT   P55051


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P55051

Recommended name:Fatty acid-binding protein, brain

EC number:

Alternative names:

Cleaved into:

GeneID:80841

Gene names  (primary ):Fabp7

Gene names  (synonym ):Blbp

Gene names  (ORF ):

Length:132

Mass:14,864

Sequence:MVDAFCATWKLTDSQNFDEYMKALGVGFATRQVGNVTKPTVIISQEGGKVVIRTQCTFKNTEISFQLGEEFEETSIDDRNCKSVIRLDGDKLIHVQKWDGKETNCVREIKDGKMVVTLTFGDVVAVRCYEKA

Tissue specificity:Expressed in brain and other neural tissues.

Induction:

Developmental stage:

Protein families:calycin superfamily


   💬 WhatsApp