ARL4A_RAT P61214
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P61214
Recommended name：ADP-ribosylation factor-like protein 4A
EC number：
Alternative names：
Cleaved into：
GeneID：29308
Gene names (primary )：Arl4a
Gene names (synonym )：Arl4
Gene names (ORF )：
Length：200
Mass：22,588
Sequence：MGNGLSDQTSILSSLPSFQSFHIVILGLDCAGKTTVLYRLQFNEFVNTVPTKGFNTEKIKVTLGNSKTVTFHFWDVGGQEKLRPLWKSYTRCTDGIVFVVDSVDVERMEEAKTELHKITRISENQGVPVLIVANKQDLRNSLSLSEIEKLLAMGELSSSTPWHLQPTCAIIGDGLKEGLEKLHDMIIKRRKMLRQQKKKR
Tissue specificity：Expressed strongly in testis and liver. Expressed slightly in heart, spleen, lung and kidney. 1
Induction：
Developmental stage：Expressed strongly in embryo at 7 dpc. Expressed slightly in embryo at 11, 15 and 17 dpc.
Protein families：