PR3D4_RAT P34207
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P34207
Recommended name：Prolactin-3D4
EC number：
Alternative names：
Cleaved into：
GeneID：24282
Gene names (primary )：Prl3d4
Gene names (synonym )：Csh1v
Gene names (ORF )：
Length：223
Mass：25,844
Sequence：MQLTLTLSGSSMQLLLLVSNLLLWENMASKPTVLVSTEDLYHRLVEQSHNTFIKAADVYREFDINFAKRSWMKDRILPLCHTASIHVPENREEVHEIKTEDLLRSIINISVSWKEPLKHFVSAVTDLPGASASMRKKAVDMKDKNLIILEGLQKIFNRTQTKVEENENFDYPAWSGLKDLQSSDEDTHLFAIYNLCRCFKSDIHKIDTYLKVLRCRVVFKNEC
Tissue specificity：Predominantly synthesized during the later stage of gestation.
Induction：
Developmental stage：
Protein families：