ATP5H_RAT   P31399


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P31399

Recommended name:ATP synthase peripheral stalk subunit d, mitochondrial By Similarity

EC number:

Alternative names:ATP synthase peripheral stalk subunit d Curated

Cleaved into:

GeneID:641434

Gene names  (primary ):Atp5pd

Gene names  (synonym ):Atp5h, Atp5jd

Gene names  (ORF ):

Length:161

Mass:18,763

Sequence:MAGRKLALKTIDWVSFVEIMPQNQKAIGNALKSWNETFHTRLASLSEKPPAIDWAYYRANVDKPGLVDDFKNKYNALKIPVPEDKYTALVDAEEKEDVKNCAQFVTGSQARVREYEKQLEKIKNMIPFDQMTIDDLNEVFPETKLDKRKYPYWPHQPIENL

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp