ATP5E_RAT   P29418


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P29418

Recommended name:ATP synthase F(1) complex subunit epsilon, mitochondrial Curated

EC number:

Alternative names:ATP synthase F1 subunit epsilon Imported

Cleaved into:

GeneID:245958

Gene names  (primary ):Atp5f1e

Gene names  (synonym ):Atp5e

Gene names  (ORF ):

Length:51

Mass:5,767

Sequence:MVAYWRQAGLSYIRFSQICAKAVRDALKTEFKANAEKTSGTSIKTVKIKKE

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp