3HIDH_RAT P29266
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P29266
Recommended name:3-hydroxyisobutyrate dehydrogenase, mitochondrial
EC number:EC:1.1.1.31
Alternative names:HIBADH
Cleaved into:
GeneID:63938
Gene names (primary ):Hibadh
Gene names (synonym ):
Gene names (ORF ):
Length:335
Mass:35,303
Sequence:MAASLGFRGAASGLRYWSGRRRPVGSLAAVCSRSMASKTPVGFIGLGNMGNPMAKNLIKHGYPLILYDVFPDVCKEFKEAGEQVASSPADVAEKADRIITMLPSSMNSIEVYSGANGILKKVKKGSLLIDSSTIDPSVSKELAKEVEKMGAVFMDAPVSGGVGAARSGNLTFMVGGVENEFAAAQELLGCMGSNVLYCGAVGSGQSAKICNNMLLAISMIGTAEAMNLGIRSGLDPKLLAKILNMSSGRCWSSDTYNPVPGVMDGVPSSNNYQGGFGTTLMAKDLGLAQDSATSTKTPILLGSVAHQIYRMMCSKGYSKKDFSSVFQYLREEETF
Tissue specificity:Higher level in kidney, liver, and heart than in muscle.
Induction:
Developmental stage:
Protein families: