RS27L_RAT P24051
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:P24051
Recommended name：Small ribosomal subunit protein eS27-like Curated
EC number：
Alternative names：
Cleaved into：
GeneID：681429
Gene names (primary )：Rps27l
Gene names (synonym )：
Gene names (ORF )：
Length：84
Mass：9,477
Sequence：MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHAQTVVLCVGCSTVLCQPTGGKARLTEGCSFRRKQH
Tissue specificity：Expressed predominantly in the striatum, hypothalamus, heart and liver and at lower levels in the cerebellum, hippocampus and pons. 1
Induction：
Developmental stage：
Protein families：