FLOWR_RAT D4A9I3
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:D4A9I3
Recommended name:Calcium channel flower homolog
EC number:
Alternative names:
Cleaved into:
GeneID:296599
Gene names (primary ):Cacfd1
Gene names (synonym ):
Gene names (ORF ):
Length:171
Mass:18,414
Sequence:MSGSVAAGAAAGPVPPAQEEGMTWWYRWLCRLAGVLGAVSCAISGLFNCVTIHPLNIAAGVWMIMNAFILLLCEAPFCCQFVEFANTVAEKVDRLRSWQKAVFYCGMAIVPIVMSLTLTTLLGNAIAFATGVLYGLSALGKKGDAISYARIQQQRQQADEEKLAETFEGEL
Tissue specificity:Expressed in calyces in the brain (at protein level) (PubMed:22813738, PubMed:28414717). Detected in cultured hippocampal neurons (at protein level) (PubMed:28414717). 2 s
Induction:
Developmental stage:
Protein families: