CAH1_RAT   B0BNN3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:B0BNN3

Recommended name:Carbonic anhydrase 1 By Similarity

EC number:EC:4.2.1.1

Alternative names:Carbonate dehydratase I By Similarity Carbonic anhydrase I By Similarity (CA-I By Similarity) Cyanamide hydratase CA1 (EC:4.2.1.69 By Similarity) . EC:4.2.1.69 (UniProtKB | ENZYME | Rhea) By Similarity

Cleaved into:

GeneID:310218

Gene names  (primary ):Ca1 By Similarity

Gene names  (synonym ):Car1 Imported

Gene names  (ORF ):

Length:261

Mass:28,300

Sequence:MASADWGYDSKNGPDQWSKLYPIANGNNQSPIDIKTSEAKHDSSLKPVSVSYNPATAKEIVNVGHSFHVVFDDSSNQSVLKGGPLADSYRLTQFHFHWGNSNDHGSEHTVDGAKYSGELHLVHWNSAKYSSAAEAISKADGLAIIGVLMKVGPANPNLQKVLDALSSVKTKGKRAPFTNFDPSSLLPSSLDYWTYFGSLTHPPLHESVTWVICKESISLSPEQLAQLRGLLSSAEGEPAVPVLSNHRPPQPLKGRTVRASF

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp