TM40L_RAT A4F267
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:A4F267
Recommended name：Mitochondrial import receptor subunit TOM40B
EC number：
Alternative names：
Cleaved into：
GeneID：304971
Gene names (primary )：Tomm40l By Similarity
Gene names (synonym )：Tomm40b Imported
Gene names (ORF )：
Length：308
Mass：34,049
Sequence：MGNTLGLAPMGTLPRWSHRREEPLPNPGSFDELHRLCKDVFPAQMEGVKLVVNKVLSSHFQVAHTVHMSALGLPGYHLHTAYAGDWQLSPTEVFPTVVGDMDSSGSLNAQVLLLLAERLRAKAVFQTQQAKFLTWQFDGEYRGDDYTATLTLGNPDLIGESVIMVAHFLQSITHRLVLGGELVYHRRPGEEGAILTLAGKYSALHWVATLNVGSGGAHASYYHKANEQVQVGVEFEANTRLQDTTFSFGYHLTLPQADMVFRGLVDSNWCVGAVLEKKMRPLPVTLALGAFLNHWRNRFHCGFSITVG
Tissue specificity：Widely expressed. Higher levels in heart, brain and liver, very low level in testis. 1
Induction：
Developmental stage：
Protein families：