GHC1_RAT   A0A0G2K5L2


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:A0A0G2K5L2

Recommended name:Mitochondrial glutamate carrier 1

EC number:

Alternative names:Glutamate/H(+) symporter 1 Solute carrier family 25 member 22

Cleaved into:

GeneID:

Gene names  (primary ):Slc25a22

Gene names  (synonym ):Gc1 1 Publication

Gene names  (ORF ):

Length:323

Mass:34,662

Sequence:MADKQISLPAKLINGGIAGLIGVTCVFPIDLAKTRLQNQQNGQRMYASMSDCLIKTIRSEGYFGMYRGAAVNLTLVTPEKAIKLAANDFFRHQLSKDGQKLTLPKEMLAGCGAGTCQVIVTTPMEMLKIQLQDAGRIAAQRKMLAAQAQLATQGGGQPSVEAPAAPRPTATQLTRDLLRNHGIAGLYKGLGATLLRDVPFSIVYFPLFANLNQLGRPSSEEKSPFYVSFLAGCVAGSAAAVAVNPCDVVKTRLQSLERGVNEDTYSGFLDCARKIWRHEGPSAFLKGAYCRALVIAPLFGIAQVVYFLGIAESLLGLLQEPQA

Tissue specificity:Detected in insulin-secreting beta-cells and pancreatic islets (at the protein level). 1

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp